General Information

  • ID:  hor004663
  • Uniprot ID:  Q3EDH8
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 3
  • Gene name:  CLE3
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE3p]: Mostly expressed in roots, stems and apex, and, to a lower extent, in seedlings, leaves, flowers, siliques and pollen.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  RPLVAEERFSGSSRLKKIRRELFERLKEMKGRSEGEETILGNTLDSKRLSPGGPDPRHH
  • Length:  59
  • Propeptide:  MASLKLWVCLVLLLVLELTSVHECRPLVAEERFSGSSRLKKIRRELFERLKEMKGRSEGEETILGNTLDSKRLSPGGPDPRHH
  • Signal peptide:  MASLKLWVCLVLLLVLELTSVHEC
  • Modification:  T51 Hydroxyproline;T54 Hydroxyproline
  • Glycosylation:  T54 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q3EDH8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004663_AF2.pdbhor004663_ESM.pdb

Physical Information

Mass: 782037 Formula: C291H486N96O89S
Absent amino acids: CQWY Common amino acids: RE
pI: 10.9 Basic residues: 16
Polar residues: 15 Hydrophobic residues: 13
Hydrophobicity: -120 Boman Index: -21137
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 66.1
Instability Index: 6348.47 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA